PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G07870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 365aa    MW: 40316.5 Da    PI: 10.1696
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G07870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-1794140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  OGLUM07G07870.1  94 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                      688*****************************.************996 PP

2Myb_DNA-binding46.96.2e-15156196345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd +l++a++ +G++ W++Iar ++ g +++ +k+rw+
  OGLUM07G07870.1 156 IWTEEEDRKLIRAHQTYGNR-WSAIARSLP-GWSENTVKNRWN 196
                      5*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-2189146IPR009057Homeodomain-like
PROSITE profilePS5129427.82989144IPR017930Myb domain
SuperFamilySSF466892.42E-2791195IPR009057Homeodomain-like
SMARTSM007175.4E-1693142IPR001005SANT/Myb domain
PfamPF002491.1E-1594140IPR001005SANT/Myb domain
CDDcd001674.76E-1697140No hitNo description
PROSITE profilePS5129413.8150203IPR017930Myb domain
SMARTSM007174.9E-14153201IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-16156197IPR009057Homeodomain-like
PfamPF002492.1E-13157196IPR001005SANT/Myb domain
CDDcd001671.03E-13157199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MATDRMPDSH FMASSNGGAC YQNTRGTPIT MGVPNLGCLV ASIGMAPSSS LMPERGLATA  60
NYNLVANFPE DAAVVPQQQQ LQAASSNSNS GLIKGGWTRE EDEVLRQMVR HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HRTLRYGSCD IPLNGIWTEE EDRKLIRAHQ TYGNRWSAIA  180
RSLPGWSENT VKNRWNATKR SLNSKCRLRK KNSEQVVPRQ PSLLKEYIHS CQHPLPNETA  240
PPASFDIGGY GTGGTIGASP TLPTVHVLGG STPLGLVMFL DLLNQATPHP PQPDLNLLNI  300
TPVVPHLNTS GYCQLDARGN CSGATVVWPA AGATPRDQRP GRPKQRRHQW QNRRHGQQWR  360
HPDGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-32922045110B-MYB
1h88_C3e-315920026156MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-315920026156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1340348GRPKQRRHQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.11e-157PREDICTED: transcription factor RAX1-like
TrEMBLA0A0E0AHL60.0A0A0E0AHL6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA025449-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-39myb domain protein 98